MEF2A (Human) Recombinant Protein (Q02) View larger

MEF2A (Human) Recombinant Protein (Q02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MEF2A (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about MEF2A (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00004205-Q02
Product name: MEF2A (Human) Recombinant Protein (Q02)
Product description: Human MEF2A partial ORF (NP_005578.1, 325 a.a. - 402 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 4205
Gene name: MEF2A
Gene alias: ADCAD1|RSRFC4|RSRFC9
Gene description: myocyte enhancer factor 2A
Genbank accession: NM_005587.1
Immunogen sequence/protein sequence: QGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISI
Protein accession: NP_005578.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00004205-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MEF2A (Human) Recombinant Protein (Q02) now

Add to cart