Brand: | Abnova |
Reference: | H00004205-M10 |
Product name: | MEF2A monoclonal antibody (M10), clone 2F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MEF2A. |
Clone: | 2F10 |
Isotype: | IgG2a Lambda |
Gene id: | 4205 |
Gene name: | MEF2A |
Gene alias: | ADCAD1|RSRFC4|RSRFC9 |
Gene description: | myocyte enhancer factor 2A |
Genbank accession: | BC013437 |
Immunogen: | MEF2A (AAH13437, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA |
Protein accession: | AAH13437 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MEF2A is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |