Brand: | Abnova |
Reference: | H00004193-M01 |
Product name: | MDM2 monoclonal antibody (M01), clone 1A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MDM2. |
Clone: | 1A7 |
Isotype: | IgG1 Kappa |
Gene id: | 4193 |
Gene name: | MDM2 |
Gene alias: | HDMX|MGC71221|hdm2 |
Gene description: | Mdm2 p53 binding protein homolog (mouse) |
Genbank accession: | NM_002392 |
Immunogen: | MDM2 (NP_002383, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC |
Protein accession: | NP_002383 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
Shipping condition: | Dry Ice |