Brand: | Abnova |
Reference: | H00004192-D01 |
Product name: | MDK MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human MDK protein. |
Gene id: | 4192 |
Gene name: | MDK |
Gene alias: | FLJ27379|MK|NEGF2 |
Gene description: | midkine (neurite growth-promoting factor 2) |
Genbank accession: | NM_001012333 |
Immunogen: | MDK (NP_001012333.1, 1 a.a. ~ 143 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
Protein accession: | NP_001012333.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of MDK transfected lysate using anti-MDK MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MDK purified MaxPab mouse polyclonal antibody (B02P) (H00004192-B02P). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |