Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MDH2 monoclonal antibody (M06), clone 2A7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about MDH2 monoclonal antibody (M06), clone 2A7
| Brand: | Abnova |
| Reference: | H00004191-M06 |
| Product name: | MDH2 monoclonal antibody (M06), clone 2A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MDH2. |
| Clone: | 2A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4191 |
| Gene name: | MDH2 |
| Gene alias: | M-MDH|MDH|MGC:3559|MOR1 |
| Gene description: | malate dehydrogenase 2, NAD (mitochondrial) |
| Genbank accession: | NM_005918 |
| Immunogen: | MDH2 (NP_005909, 134 a.a. ~ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGS |
| Protein accession: | NP_005909 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MDH2 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Metabolomics-driven approach for the improvement of Chinese hamster ovary cell growth: overexpression of malate dehydrogenase II.Chong WP, Reddy SG, Yusufi FN, Lee DY, Wong NS, Heng CK, Yap MG, Ho YS. J Biotechnol. 2010 Apr 2. [Epub ahead of print] |