MDH2 monoclonal antibody (M03), clone 2B7 View larger

MDH2 monoclonal antibody (M03), clone 2B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MDH2 monoclonal antibody (M03), clone 2B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MDH2 monoclonal antibody (M03), clone 2B7

Brand: Abnova
Reference: H00004191-M03
Product name: MDH2 monoclonal antibody (M03), clone 2B7
Product description: Mouse monoclonal antibody raised against a partial recombinant MDH2.
Clone: 2B7
Isotype: IgG2b Kappa
Gene id: 4191
Gene name: MDH2
Gene alias: M-MDH|MDH|MGC:3559|MOR1
Gene description: malate dehydrogenase 2, NAD (mitochondrial)
Genbank accession: NM_005918
Immunogen: MDH2 (NP_005909, 134 a.a. ~ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGS
Protein accession: NP_005909
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004191-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MDH2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MDH2 monoclonal antibody (M03), clone 2B7 now

Add to cart