Brand: | Abnova |
Reference: | H00004191-M03 |
Product name: | MDH2 monoclonal antibody (M03), clone 2B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MDH2. |
Clone: | 2B7 |
Isotype: | IgG2b Kappa |
Gene id: | 4191 |
Gene name: | MDH2 |
Gene alias: | M-MDH|MDH|MGC:3559|MOR1 |
Gene description: | malate dehydrogenase 2, NAD (mitochondrial) |
Genbank accession: | NM_005918 |
Immunogen: | MDH2 (NP_005909, 134 a.a. ~ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGS |
Protein accession: | NP_005909 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MDH2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |