MDH1 monoclonal antibody (M01), clone 2B11-B7 View larger

MDH1 monoclonal antibody (M01), clone 2B11-B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MDH1 monoclonal antibody (M01), clone 2B11-B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Tr

More info about MDH1 monoclonal antibody (M01), clone 2B11-B7

Brand: Abnova
Reference: H00004190-M01
Product name: MDH1 monoclonal antibody (M01), clone 2B11-B7
Product description: Mouse monoclonal antibody raised against a full length recombinant MDH1.
Clone: 2B11-B7
Isotype: IgG2b Kappa
Gene id: 4190
Gene name: MDH1
Gene alias: MDH-s|MDHA|MGC:1375|MOR2
Gene description: malate dehydrogenase 1, NAD (soluble)
Genbank accession: BC001484
Immunogen: MDH1 (AAH01484.1, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Protein accession: AAH01484.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004190-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged MDH1 is approximately 3ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MDH1 monoclonal antibody (M01), clone 2B11-B7 now

Add to cart