Brand: | Abnova |
Reference: | H00004190-M01 |
Product name: | MDH1 monoclonal antibody (M01), clone 2B11-B7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MDH1. |
Clone: | 2B11-B7 |
Isotype: | IgG2b Kappa |
Gene id: | 4190 |
Gene name: | MDH1 |
Gene alias: | MDH-s|MDHA|MGC:1375|MOR2 |
Gene description: | malate dehydrogenase 1, NAD (soluble) |
Genbank accession: | BC001484 |
Immunogen: | MDH1 (AAH01484.1, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA |
Protein accession: | AAH01484.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MDH1 is approximately 3ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |