MCM3 monoclonal antibody (M03), clone 3E1 View larger

MCM3 monoclonal antibody (M03), clone 3E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCM3 monoclonal antibody (M03), clone 3E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about MCM3 monoclonal antibody (M03), clone 3E1

Brand: Abnova
Reference: H00004172-M03
Product name: MCM3 monoclonal antibody (M03), clone 3E1
Product description: Mouse monoclonal antibody raised against a partial recombinant MCM3.
Clone: 3E1
Isotype: IgG2b Kappa
Gene id: 4172
Gene name: MCM3
Gene alias: HCC5|MGC1157|P1-MCM3|P1.h|RLFB
Gene description: minichromosome maintenance complex component 3
Genbank accession: NM_002388
Immunogen: MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Protein accession: NP_002379
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004172-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004172-M03-1-1-1.jpg
Application image note: MCM3 monoclonal antibody (M03), clone 3E1 Western Blot analysis of MCM3 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MCM3 monoclonal antibody (M03), clone 3E1 now

Add to cart