MBNL1 monoclonal antibody (M02), clone 3E7 View larger

MBNL1 monoclonal antibody (M02), clone 3E7

H00004154-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MBNL1 monoclonal antibody (M02), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about MBNL1 monoclonal antibody (M02), clone 3E7

Brand: Abnova
Reference: H00004154-M02
Product name: MBNL1 monoclonal antibody (M02), clone 3E7
Product description: Mouse monoclonal antibody raised against a full length recombinant MBNL1.
Clone: 3E7
Isotype: IgG2a Kappa
Gene id: 4154
Gene name: MBNL1
Gene alias: DKFZp686P06174|EXP|EXP35|EXP40|EXP42|KIAA0428|MBNL
Gene description: muscleblind-like (Drosophila)
Genbank accession: BC043493
Immunogen: MBNL1 (AAH43493, 1 a.a. ~ 382 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Protein accession: AAH43493
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004154-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004154-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MBNL1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Development of an AP-FRET Based Analysis for Characterizing RNA-Protein Interactions in Myotonic Dystrophy (DM1).Rehman S, Gladman JT, Periasamy A, Sun Y, Mahadevan MS
PLoS One. 2014 Apr 29;9(4):e95957. doi: 10.1371/journal.pone.0095957. eCollection 2014.

Reviews

Buy MBNL1 monoclonal antibody (M02), clone 3E7 now

Add to cart