MBNL1 monoclonal antibody (M01C), clone 1D11 View larger

MBNL1 monoclonal antibody (M01C), clone 1D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MBNL1 monoclonal antibody (M01C), clone 1D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MBNL1 monoclonal antibody (M01C), clone 1D11

Brand: Abnova
Reference: H00004154-M01C
Product name: MBNL1 monoclonal antibody (M01C), clone 1D11
Product description: Mouse monoclonal antibody raised against a full-length recombinant MBNL1.
Clone: 1D11
Isotype: IgG1 Kappa
Gene id: 4154
Gene name: MBNL1
Gene alias: DKFZp686P06174|EXP|EXP35|EXP40|EXP42|KIAA0428|MBNL
Gene description: muscleblind-like (Drosophila)
Genbank accession: BC050535
Immunogen: MBNL1 (AAH50535, 1 a.a. ~ 343 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Protein accession: AAH50535
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004154-M01C-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (63.47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MBNL1 monoclonal antibody (M01C), clone 1D11 now

Add to cart