MBD1 monoclonal antibody (M04), clone 2H3 View larger

MBD1 monoclonal antibody (M04), clone 2H3

H00004152-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MBD1 monoclonal antibody (M04), clone 2H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MBD1 monoclonal antibody (M04), clone 2H3

Brand: Abnova
Reference: H00004152-M04
Product name: MBD1 monoclonal antibody (M04), clone 2H3
Product description: Mouse monoclonal antibody raised against a partial recombinant MBD1.
Clone: 2H3
Isotype: IgG2b Kappa
Gene id: 4152
Gene name: MBD1
Gene alias: CXXC3|PCM1|RFT
Gene description: methyl-CpG binding domain protein 1
Genbank accession: NM_015846
Immunogen: MBD1 (NP_056671, 415 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Protein accession: NP_056671
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004152-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004152-M04-1-6-1.jpg
Application image note: MBD1 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MBD1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MBD1 monoclonal antibody (M04), clone 2H3 now

Add to cart