Brand: | Abnova |
Reference: | H00004152-M03 |
Product name: | MBD1 monoclonal antibody (M03), clone 4F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MBD1. |
Clone: | 4F6 |
Isotype: | IgG2b Kappa |
Gene id: | 4152 |
Gene name: | MBD1 |
Gene alias: | CXXC3|PCM1|RFT |
Gene description: | methyl-CpG binding domain protein 1 |
Genbank accession: | NM_015846 |
Immunogen: | MBD1 (NP_056671, 415 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE |
Protein accession: | NP_056671 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MBD1 monoclonal antibody (M03), clone 4F6. Western Blot analysis of MBD1 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |