Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAZ (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about MAZ (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00004150-Q01 |
| Product name: | MAZ (Human) Recombinant Protein (Q01) |
| Product description: | Human MAZ partial ORF ( NP_002374, 332 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 4150 |
| Gene name: | MAZ |
| Gene alias: | PUR1|Pur-1|SAF-1|SAF-2|ZF87|ZNF801|Zif87 |
| Gene description: | MYC-associated zinc finger protein (purine-binding transcription factor) |
| Genbank accession: | NM_002383 |
| Immunogen sequence/protein sequence: | YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ |
| Protein accession: | NP_002374 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Loss of Function Thrombospondin-1 Mutations in Familial Pulmonary Hypertension.Maloney JP, Stearman RS, Bull TM, Calabrese DW, Tripp-Addison ML, Wick MJ, Broeckel U, Robbins IM, Wheeler LA, Cogan JD, Loyd JE. Am J Physiol Lung Cell Mol Physiol. 2011 Dec 23. [Epub ahead of print] |