Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAP4 monoclonal antibody (M03), clone 7C9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about MAP4 monoclonal antibody (M03), clone 7C9
| Brand: | Abnova |
| Reference: | H00004134-M03 |
| Product name: | MAP4 monoclonal antibody (M03), clone 7C9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MAP4. |
| Clone: | 7C9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4134 |
| Gene name: | MAP4 |
| Gene alias: | DKFZp779A1753|MGC8617 |
| Gene description: | microtubule-associated protein 4 |
| Genbank accession: | NM_030885.2 |
| Immunogen: | MAP4 (NP_112147.2, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA |
| Protein accession: | NP_112147.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MAP4 expression in transfected 293T cell line by MAP4 monoclonal antibody (M03), clone 7C9. Lane 1: MAP4 transfected lysate(10.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |