H00004124-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00004124-M01 |
Product name: | MAN2A1 monoclonal antibody (M01), clone 1G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAN2A1. |
Clone: | 1G9 |
Isotype: | IgG2a Kappa |
Gene id: | 4124 |
Gene name: | MAN2A1 |
Gene alias: | GOLIM7|MANA2|MANII |
Gene description: | mannosidase, alpha, class 2A, member 1 |
Genbank accession: | NM_002372 |
Immunogen: | MAN2A1 (NP_002363, 1045 a.a. ~ 1144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR |
Protein accession: | NP_002363 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Quantitative Proteomic Analysis of PCSK9 Gain of Function in Human Hepatic HuH7 Cells.Denis N, Palmer-Smith H, Elisma F, Busuttil A, Wright TG, Khalil MB, Prat A, Seidah NG, Chretien M, Mayne J, Figeys D. J Proteome Res. 2011 Mar 10. [Epub ahead of print] |