MAK monoclonal antibody (M01), clone 3E5 View larger

MAK monoclonal antibody (M01), clone 3E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAK monoclonal antibody (M01), clone 3E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about MAK monoclonal antibody (M01), clone 3E5

Brand: Abnova
Reference: H00004117-M01
Product name: MAK monoclonal antibody (M01), clone 3E5
Product description: Mouse monoclonal antibody raised against a partial recombinant MAK.
Clone: 3E5
Isotype: IgG2a Kappa
Gene id: 4117
Gene name: MAK
Gene alias: dJ417M14.2
Gene description: male germ cell-associated kinase
Genbank accession: BC039825
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Protein accession: AAH39825
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004117-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00004117-M01-4-12-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MAK on HepG2 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAK monoclonal antibody (M01), clone 3E5 now

Add to cart