H00004112-M09_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004112-M09 |
Product name: | MAGEB1 monoclonal antibody (M09), clone 3C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGEB1. |
Clone: | 3C1 |
Isotype: | IgG2a Kappa |
Gene id: | 4112 |
Gene name: | MAGEB1 |
Gene alias: | DAM10|MAGE-Xp|MAGEL1|MGC9322 |
Gene description: | melanoma antigen family B, 1 |
Genbank accession: | NM_177415 |
Immunogen: | MAGEB1 (NP_803134.1, 86 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDF |
Protein accession: | NP_803134.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged MAGEB1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |