Brand: | Abnova |
Reference: | H00004110-M01A |
Product name: | MAGEA11 monoclonal antibody (M01A), clone 3A6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MAGEA11. |
Clone: | 3A6 |
Isotype: | IgM kappa |
Gene id: | 4110 |
Gene name: | MAGEA11 |
Gene alias: | MAGE-11|MAGE11|MAGEA-11|MGC10511 |
Gene description: | melanoma antigen family A, 11 |
Genbank accession: | BC004479.1 |
Immunogen: | MAGEA11 (AAH04479.1, 1 a.a. ~ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV |
Protein accession: | AAH04479.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (60.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MAGEA11 monoclonal antibody (M01A), clone 3A6 Western Blot analysis of MAGEA11 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |