MAGEA11 monoclonal antibody (M01A), clone 3A6 View larger

MAGEA11 monoclonal antibody (M01A), clone 3A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAGEA11 monoclonal antibody (M01A), clone 3A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MAGEA11 monoclonal antibody (M01A), clone 3A6

Brand: Abnova
Reference: H00004110-M01A
Product name: MAGEA11 monoclonal antibody (M01A), clone 3A6
Product description: Mouse monoclonal antibody raised against a full length recombinant MAGEA11.
Clone: 3A6
Isotype: IgM kappa
Gene id: 4110
Gene name: MAGEA11
Gene alias: MAGE-11|MAGE11|MAGEA-11|MGC10511
Gene description: melanoma antigen family A, 11
Genbank accession: BC004479.1
Immunogen: MAGEA11 (AAH04479.1, 1 a.a. ~ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV
Protein accession: AAH04479.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004110-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (60.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004110-M01A-1-9-1.jpg
Application image note: MAGEA11 monoclonal antibody (M01A), clone 3A6 Western Blot analysis of MAGEA11 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAGEA11 monoclonal antibody (M01A), clone 3A6 now

Add to cart