Cart 178 Product Products 20 373,74 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-Ly...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
20 373,74 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 178 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 373,74 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 20 373,74 €
Data sheet of MAGEA11 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about MAGEA11 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00004110-D01P |
| Product name: | MAGEA11 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human MAGEA11 protein. |
| Gene id: | 4110 |
| Gene name: | MAGEA11 |
| Gene alias: | MAGE-11|MAGE11|MAGEA-11|MGC10511 |
| Gene description: | melanoma antigen family A, 11 |
| Genbank accession: | ENST00000370417 |
| Immunogen: | MAGEA11 (ENSP00000359445, 1 a.a. ~ 319 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV |
| Protein accession: | ENSP00000359445 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 MaxPab rabbit polyclonal antibody. Lane 1: MAGEA11 transfected lysate(35.50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |