MAGEA10 MaxPab mouse polyclonal antibody (B01) View larger

MAGEA10 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAGEA10 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about MAGEA10 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004109-B01
Product name: MAGEA10 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MAGEA10 protein.
Gene id: 4109
Gene name: MAGEA10
Gene alias: MAGE10|MGC10599
Gene description: melanoma antigen family A, 10
Genbank accession: BC004105
Immunogen: MAGEA10 (AAH04105.1, 1 a.a. ~ 370 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIKNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIIFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
Protein accession: AAH04105.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004109-B01-13-15-1.jpg
Application image note: Western Blot analysis of MAGEA10 expression in transfected 293T cell line (H00004109-T03) by MAGEA10 MaxPab polyclonal antibody.

Lane 1: MAGEA10 transfected lysate(40.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAGEA10 MaxPab mouse polyclonal antibody (B01) now

Add to cart