Brand: | Abnova |
Reference: | H00004102-M02 |
Product name: | MAGEA3 monoclonal antibody (M02), clone 4D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGEA3. |
Clone: | 4D9 |
Isotype: | IgG2a Kappa |
Gene id: | 4102 |
Gene name: | MAGEA3 |
Gene alias: | HIP8|HYPD|MAGE3|MAGEA6|MGC14613 |
Gene description: | melanoma antigen family A, 3 |
Genbank accession: | NM_005362 |
Immunogen: | MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA |
Protein accession: | NP_005353 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MAGEA3 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |