Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAGEA3 monoclonal antibody (M01), clone 6D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about MAGEA3 monoclonal antibody (M01), clone 6D10
| Brand: | Abnova |
| Reference: | H00004102-M01 |
| Product name: | MAGEA3 monoclonal antibody (M01), clone 6D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGEA3. |
| Clone: | 6D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4102 |
| Gene name: | MAGEA3 |
| Gene alias: | HIP8|HYPD|MAGE3|MAGEA6|MGC14613 |
| Gene description: | melanoma antigen family A, 3 |
| Genbank accession: | NM_005362 |
| Immunogen: | MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA |
| Protein accession: | NP_005353 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Alpha-type-1 polarized dendritic cell-based vaccination in recurrent high-grade glioma: a phase I clinical trial.Akiyama Y, Oshita C, Kume A, Iizuka A, Miyata H, Komiyama M, Ashizawa T, Yagoto M, Abe Y, Mitsuya K, Watanabe R, Sugino T, Yamaguchi K, Nakasu Y. BMC Cancer. 2012 Dec 27;12:623. doi: 10.1186/1471-2407-12-623. |