Brand: | Abnova |
Reference: | H00004102-A01 |
Product name: | MAGEA3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MAGEA3. |
Gene id: | 4102 |
Gene name: | MAGEA3 |
Gene alias: | HIP8|HYPD|MAGE3|MAGEA6|MGC14613 |
Gene description: | melanoma antigen family A, 3 |
Genbank accession: | NM_005362 |
Immunogen: | MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA |
Protein accession: | NP_005353 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004102-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004102-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (33.92 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00004102-A01-2-A5-1.jpg](http://www.abnova.com/application_image/H00004102-A01-2-A5-1.jpg) |
Application image note: | MAGEA3 polyclonal antibody (A01). Western Blot analysis of MAGEA3 expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |