MAGEA1 monoclonal antibody (M01), clone 3H5 View larger

MAGEA1 monoclonal antibody (M01), clone 3H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAGEA1 monoclonal antibody (M01), clone 3H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MAGEA1 monoclonal antibody (M01), clone 3H5

Brand: Abnova
Reference: H00004100-M01
Product name: MAGEA1 monoclonal antibody (M01), clone 3H5
Product description: Mouse monoclonal antibody raised against a partial recombinant MAGEA1.
Clone: 3H5
Isotype: IgG2a Kappa
Gene id: 4100
Gene name: MAGEA1
Gene alias: MAGE1|MGC9326
Gene description: melanoma antigen family A, 1 (directs expression of antigen MZ2-E)
Genbank accession: NM_004988
Immunogen: MAGEA1 (NP_004979, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVL
Protein accession: NP_004979
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004100-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.88 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004100-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MAGEA1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAGEA1 monoclonal antibody (M01), clone 3H5 now

Add to cart