Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMAD7 monoclonal antibody (M09), clone 1G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about SMAD7 monoclonal antibody (M09), clone 1G10
| Brand: | Abnova |
| Reference: | H00004092-M09 |
| Product name: | SMAD7 monoclonal antibody (M09), clone 1G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMAD7. |
| Clone: | 1G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4092 |
| Gene name: | SMAD7 |
| Gene alias: | CRCS3|FLJ16482|MADH7|MADH8 |
| Gene description: | SMAD family member 7 |
| Genbank accession: | NM_005904 |
| Immunogen: | SMAD7 (NP_005895, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH |
| Protein accession: | NP_005895 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SMAD7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Aberrant expression in multiple components of the transforming growth factor-β1-induced Smad signaling pathway during 7,12-dimethylbenz[a]anthracene-induced hamster buccal-pouch squamous-cell carcinogenesis.Chen YK, Yang SH, Huang AH, Hsue SS, Lin LM. Oral Oncol. 2011 Feb 26. [Epub ahead of print] |