SMAD7 monoclonal antibody (M07), clone 4G11 View larger

SMAD7 monoclonal antibody (M07), clone 4G11

H00004092-M07_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD7 monoclonal antibody (M07), clone 4G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA

More info about SMAD7 monoclonal antibody (M07), clone 4G11

Brand: Abnova
Reference: H00004092-M07
Product name: SMAD7 monoclonal antibody (M07), clone 4G11
Product description: Mouse monoclonal antibody raised against a partial recombinant SMAD7.
Clone: 4G11
Isotype: IgG2a Kappa
Gene id: 4092
Gene name: SMAD7
Gene alias: CRCS3|FLJ16482|MADH7|MADH8
Gene description: SMAD family member 7
Genbank accession: NM_005904
Immunogen: SMAD7 (NP_005895, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH
Protein accession: NP_005895
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004092-M07-2-A5-1.jpg
Application image note: SMAD7 monoclonal antibody (M07), clone 4G11. Western Blot analysis of SMAD7 expression in human ovarian cancer.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SMAD7 monoclonal antibody (M07), clone 4G11 now

Add to cart