SMAD6 monoclonal antibody (M04), clone 4F8 View larger

SMAD6 monoclonal antibody (M04), clone 4F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD6 monoclonal antibody (M04), clone 4F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SMAD6 monoclonal antibody (M04), clone 4F8

Brand: Abnova
Reference: H00004091-M04
Product name: SMAD6 monoclonal antibody (M04), clone 4F8
Product description: Mouse monoclonal antibody raised against a partial recombinant SMAD6.
Clone: 4F8
Isotype: IgG2a Kappa
Gene id: 4091
Gene name: SMAD6
Gene alias: HsT17432|MADH6|MADH7
Gene description: SMAD family member 6
Genbank accession: NM_005585
Immunogen: SMAD6 (NP_005576, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
Protein accession: NP_005576
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004091-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged SMAD6 is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMAD6 monoclonal antibody (M04), clone 4F8 now

Add to cart