SMAD5 monoclonal antibody (M08), clone 5E12 View larger

SMAD5 monoclonal antibody (M08), clone 5E12

H00004090-M08_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD5 monoclonal antibody (M08), clone 5E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SMAD5 monoclonal antibody (M08), clone 5E12

Brand: Abnova
Reference: H00004090-M08
Product name: SMAD5 monoclonal antibody (M08), clone 5E12
Product description: Mouse monoclonal antibody raised against a partial recombinant SMAD5.
Clone: 5E12
Isotype: IgG1 Kappa
Gene id: 4090
Gene name: SMAD5
Gene alias: DKFZp781C1895|DKFZp781O1323|Dwfc|JV5-1|MADH5
Gene description: SMAD family member 5
Genbank accession: BC009682
Immunogen: SMAD5 (AAH09682, 105 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN
Protein accession: AAH09682
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004090-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004090-M08-1-1-1.jpg
Application image note: SMAD5 monoclonal antibody (M08), clone 5E12 Western Blot analysis of SMAD5 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMAD5 monoclonal antibody (M08), clone 5E12 now

Add to cart