SMAD4 monoclonal antibody (M08), clone 2C1 View larger

SMAD4 monoclonal antibody (M08), clone 2C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD4 monoclonal antibody (M08), clone 2C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMAD4 monoclonal antibody (M08), clone 2C1

Brand: Abnova
Reference: H00004089-M08
Product name: SMAD4 monoclonal antibody (M08), clone 2C1
Product description: Mouse monoclonal antibody raised against a partial recombinant SMAD4.
Clone: 2C1
Isotype: IgG2a Kappa
Gene id: 4089
Gene name: SMAD4
Gene alias: DPC4|JIP|MADH4
Gene description: SMAD family member 4
Genbank accession: NM_005359
Immunogen: SMAD4 (NP_005350, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHD
Protein accession: NP_005350
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004089-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMAD4 monoclonal antibody (M08), clone 2C1 now

Add to cart