SMAD3 (Human) Recombinant Protein (Q03) View larger

SMAD3 (Human) Recombinant Protein (Q03)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD3 (Human) Recombinant Protein (Q03)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SMAD3 (Human) Recombinant Protein (Q03)

Brand: Abnova
Reference: H00004088-Q03
Product name: SMAD3 (Human) Recombinant Protein (Q03)
Product description: Human SMAD3 partial ORF (NP_005893, 147 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 4088
Gene name: SMAD3
Gene alias: DKFZp586N0721|DKFZp686J10186|HSPC193|HsT17436|JV15-2|MADH3|MGC60396
Gene description: SMAD family member 3
Genbank accession: NM_005902
Immunogen sequence/protein sequence: PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC
Protein accession: NP_005893
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00004088-Q03-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMAD3 (Human) Recombinant Protein (Q03) now

Add to cart