Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMAD3 monoclonal antibody (M21), clone 2G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA,WB-Re |
More info about SMAD3 monoclonal antibody (M21), clone 2G4
| Brand: | Abnova |
| Reference: | H00004088-M21 |
| Product name: | SMAD3 monoclonal antibody (M21), clone 2G4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SMAD3. |
| Clone: | 2G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4088 |
| Gene name: | SMAD3 |
| Gene alias: | DKFZp586N0721|DKFZp686J10186|HSPC193|HsT17436|JV15-2|MADH3|MGC60396 |
| Gene description: | SMAD family member 3 |
| Genbank accession: | NM_005902 |
| Immunogen: | SMAD3 (NP_005893, 147 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC |
| Protein accession: | NP_005893 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.27 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | SMAD3 monoclonal antibody (M21), clone 2G4 Western Blot analysis of SMAD3 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |