SMAD2 monoclonal antibody (M10), clone 4G2 View larger

SMAD2 monoclonal antibody (M10), clone 4G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD2 monoclonal antibody (M10), clone 4G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMAD2 monoclonal antibody (M10), clone 4G2

Brand: Abnova
Reference: H00004087-M10
Product name: SMAD2 monoclonal antibody (M10), clone 4G2
Product description: Mouse monoclonal antibody raised against a full-length recombinant SMAD2.
Clone: 4G2
Isotype: IgG2b Kappa
Gene id: 4087
Gene name: SMAD2
Gene alias: JV18|JV18-1|MADH2|MADR2|MGC22139|MGC34440|hMAD-2|hSMAD2
Gene description: SMAD family member 2
Genbank accession: NM_005901
Immunogen: SMAD2 (NP_005892, 16 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSH
Protein accession: NP_005892
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004087-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMAD2 monoclonal antibody (M10), clone 4G2 now

Add to cart