Brand: | Abnova |
Reference: | H00004087-M10 |
Product name: | SMAD2 monoclonal antibody (M10), clone 4G2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SMAD2. |
Clone: | 4G2 |
Isotype: | IgG2b Kappa |
Gene id: | 4087 |
Gene name: | SMAD2 |
Gene alias: | JV18|JV18-1|MADH2|MADR2|MGC22139|MGC34440|hMAD-2|hSMAD2 |
Gene description: | SMAD family member 2 |
Genbank accession: | NM_005901 |
Immunogen: | SMAD2 (NP_005892, 16 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSH |
Protein accession: | NP_005892 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |