Brand: | Abnova |
Reference: | H00004087-M07 |
Product name: | SMAD2 monoclonal antibody (M07), clone 2D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SMAD2. |
Clone: | 2D7 |
Isotype: | IgG2a Kappa |
Gene id: | 4087 |
Gene name: | SMAD2 |
Gene alias: | JV18|JV18-1|MADH2|MADR2|MGC22139|MGC34440|hMAD-2|hSMAD2 |
Gene description: | SMAD family member 2 |
Genbank accession: | BC025699 |
Immunogen: | SMAD2 (AAH25699, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY |
Protein accession: | AAH25699 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SMAD2 monoclonal antibody (M07), clone 2D7 Western Blot analysis of SMAD2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |