SMAD2 monoclonal antibody (M07), clone 2D7 View larger

SMAD2 monoclonal antibody (M07), clone 2D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD2 monoclonal antibody (M07), clone 2D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,PLA-Ce

More info about SMAD2 monoclonal antibody (M07), clone 2D7

Brand: Abnova
Reference: H00004087-M07
Product name: SMAD2 monoclonal antibody (M07), clone 2D7
Product description: Mouse monoclonal antibody raised against a partial recombinant SMAD2.
Clone: 2D7
Isotype: IgG2a Kappa
Gene id: 4087
Gene name: SMAD2
Gene alias: JV18|JV18-1|MADH2|MADR2|MGC22139|MGC34440|hMAD-2|hSMAD2
Gene description: SMAD family member 2
Genbank accession: BC025699
Immunogen: SMAD2 (AAH25699, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
Protein accession: AAH25699
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004087-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004087-M07-1-1-1.jpg
Application image note: SMAD2 monoclonal antibody (M07), clone 2D7 Western Blot analysis of SMAD2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy SMAD2 monoclonal antibody (M07), clone 2D7 now

Add to cart