Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMAD1 monoclonal antibody (M02), clone 1D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SMAD1 monoclonal antibody (M02), clone 1D3
| Brand: | Abnova |
| Reference: | H00004086-M02 |
| Product name: | SMAD1 monoclonal antibody (M02), clone 1D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMAD1. |
| Clone: | 1D3 |
| Isotype: | IgG1 kappa |
| Gene id: | 4086 |
| Gene name: | SMAD1 |
| Gene alias: | BSP1|JV4-1|JV41|MADH1|MADR1 |
| Gene description: | SMAD family member 1 |
| Genbank accession: | NM_005900 |
| Immunogen: | SMAD1 (NP_005891, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE |
| Protein accession: | NP_005891 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human salivary gland tissue. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |