Brand: | Abnova |
Reference: | H00004082-M04 |
Product name: | MARCKS monoclonal antibody (M04), clone 2H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MARCKS. |
Clone: | 2H4 |
Isotype: | IgG1 Kappa |
Gene id: | 4082 |
Gene name: | MARCKS |
Gene alias: | 80K-L|FLJ14368|FLJ90045|MACS|PKCSL|PRKCSL |
Gene description: | myristoylated alanine-rich protein kinase C substrate |
Genbank accession: | NM_002356 |
Immunogen: | MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP |
Protein accession: | NP_002347 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.78 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | MARCKS monoclonal antibody (M04), clone 2H4. Western Blot analysis of MARCKS expression in Raw 264.7 ( Cat # L024V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |