Brand: | Abnova |
Reference: | H00004072-M36 |
Product name: | EPCAM monoclonal antibody (M36), clone 2F34 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPCAM. |
Clone: | 2F34 |
Isotype: | IgG1 Kappa |
Gene id: | 4072 |
Gene name: | EPCAM |
Gene alias: | 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2 |
Gene description: | epithelial cell adhesion molecule |
Genbank accession: | NM_002354.1 |
Immunogen: | EPCAM (NP_002345.1, 24 a.a. ~ 265 a.a) partial recombinant protein with his-flag-strepII tag. |
Immunogen sequence/protein sequence: | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
Protein accession: | NP_002345.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (29.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |