EPCAM (Human) Recombinant Protein View larger

EPCAM (Human) Recombinant Protein

New product

796,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPCAM (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesHuman
ApplicationsWB,ELISA,SDS-PAGE,PI

More info about EPCAM (Human) Recombinant Protein

Brand: Abnova
Reference: H00004072-H02
Product name: EPCAM (Human) Recombinant Protein
Product description: Purified EPCAM (NP_002345.1 24 a.a. - 265 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Gene id: 4072
Gene name: EPCAM
Gene alias: 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2
Gene description: epithelial cell adhesion molecule
Genbank accession: NM_002354.1
Immunogen sequence/protein sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Protein accession: NP_002345.1
Form: Liquid
Concentration: ≥ 10 ug/ml
Host cell: Human HEK293H cells
Preparation method: Transfection of pSuper-EPCAM plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
Storage buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: SDS-PAGE and Western Blot
Quality control testing picture: qc_test-H00004072-H02-1.jpg
Tag: His-Flag-StrepII
Product type: Proteins
Host species: Human
Antigen species / target species: Human
Applications: WB,ELISA,SDS-PAGE,PI
Shipping condition: Dry Ice

Reviews

Buy EPCAM (Human) Recombinant Protein now

Add to cart