Brand: | Abnova |
Reference: | H00004072-H01 |
Product name: | EPCAM (Human) Recombinant Protein |
Product description: | Purified EPCAM (NP_002345.1 24 a.a. - 265 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
Gene id: | 4072 |
Gene name: | EPCAM |
Gene alias: | 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2 |
Gene description: | epithelial cell adhesion molecule |
Genbank accession: | NM_002354.1 |
Immunogen sequence/protein sequence: | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
Protein accession: | NP_002345.1 |
Form: | Liquid |
Concentration: | ⥠10 ug/ml |
Host cell: | Human HEK293T cells |
Preparation method: | Transfection of pSuper-EPCAM plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column. |
Storage buffer: | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | SDS-PAGE and Western Blot |
Quality control testing picture: |  |
Tag: | His-Flag-StrepII |
Product type: | Proteins |
Host species: | Human |
Antigen species / target species: | Human |
Applications: | WB,ELISA,SDS-PAGE,PI |
Shipping condition: | Dry Ice |