Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SH2D1A monoclonal antibody (M01), clone 1C9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SH2D1A monoclonal antibody (M01), clone 1C9
| Brand: | Abnova |
| Reference: | H00004068-M01 |
| Product name: | SH2D1A monoclonal antibody (M01), clone 1C9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SH2D1A. |
| Clone: | 1C9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4068 |
| Gene name: | SH2D1A |
| Gene alias: | DSHP|EBVS|FLJ18687|FLJ92177|IMD5|LYP|MTCP1|SAP|XLP|XLPD |
| Gene description: | SH2 domain protein 1A |
| Genbank accession: | BC020732 |
| Immunogen: | SH2D1A (AAH20732, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP |
| Protein accession: | AAH20732 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.82 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SH2D1A monoclonal antibody (M01), clone 1C9 Western Blot analysis of SH2D1A expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Early commitment of naive human CD4(+) T cells to the T follicular helper (T(FH)) cell lineage is induced by IL-12.Ma CS, Suryani S, Avery DT, Chan A, Nanan R, Santner-Nanan B, Deenick EK, Tangye SG. Immunol Cell Biol. 2009 Sep 1. [Epub ahead of print] |