Brand: | Abnova |
Reference: | H00004062-M01 |
Product name: | LY6H monoclonal antibody (M01), clone 3E10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LY6H. |
Clone: | 3E10 |
Isotype: | IgG1 Kappa |
Gene id: | 4062 |
Gene name: | LY6H |
Gene alias: | NMLY6 |
Gene description: | lymphocyte antigen 6 complex, locus H |
Genbank accession: | BC028894 |
Immunogen: | LY6H (AAH28894, 26 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP |
Protein accession: | AAH28894 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 2 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Quantitative profiling of brain lipid raft proteome in a mouse model of fragile x syndrome.Kalinowska M, Castillo C, Francesconi A PLoS One. 2015 Apr 7;10(4):e0121464. doi: 10.1371/journal.pone.0121464. eCollection 2015. |