Brand: | Abnova |
Reference: | H00004053-M01 |
Product name: | LTBP2 monoclonal antibody (M01), clone 5D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LTBP2. |
Clone: | 5D7 |
Isotype: | IgG2a Kappa |
Gene id: | 4053 |
Gene name: | LTBP2 |
Gene alias: | C14orf141|LTBP3|MSTP031 |
Gene description: | latent transforming growth factor beta binding protein 2 |
Genbank accession: | NM_000428 |
Immunogen: | LTBP2 (NP_000419, 1709 a.a. ~ 1818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT |
Protein accession: | NP_000419 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged LTBP2 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |