Brand: | Abnova |
Reference: | H00004051-M01 |
Product name: | CYP4F3 monoclonal antibody (M01), clone 4E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP4F3. |
Clone: | 4E11 |
Isotype: | IgG2b Kappa |
Gene id: | 4051 |
Gene name: | CYP4F3 |
Gene alias: | CPF3|CYP4F|LTB4H |
Gene description: | cytochrome P450, family 4, subfamily F, polypeptide 3 |
Genbank accession: | NM_000896 |
Immunogen: | CYP4F3 (NP_000887, 100 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM |
Protein accession: | NP_000887 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged CYP4F3 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |