Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LTA monoclonal antibody (M50), clone 4H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about LTA monoclonal antibody (M50), clone 4H7
| Brand: | Abnova |
| Reference: | H00004049-M50 |
| Product name: | LTA monoclonal antibody (M50), clone 4H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LTA. |
| Clone: | 4H7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4049 |
| Gene name: | LTA |
| Gene alias: | LT|TNFB|TNFSF1 |
| Gene description: | lymphotoxin alpha (TNF superfamily, member 1) |
| Genbank accession: | BC034729.1 |
| Immunogen: | Recombinant Flag/His fusion protein corresponding to amino acids 58-205 of human LTA. |
| Immunogen sequence/protein sequence: | HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Protein accession: | AAH34729.1 |
| Form: | Liquid |
| Recommend dilutions: | The optimal working dilution should be determined by the end user. |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (18.48 KDa) . |
| Conjugate tag: | Flag/His |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |