Brand: | Abnova |
Reference: | H00004049-M50 |
Product name: | LTA monoclonal antibody (M50), clone 4H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LTA. |
Clone: | 4H7 |
Isotype: | IgG1 Kappa |
Gene id: | 4049 |
Gene name: | LTA |
Gene alias: | LT|TNFB|TNFSF1 |
Gene description: | lymphotoxin alpha (TNF superfamily, member 1) |
Genbank accession: | BC034729.1 |
Immunogen: | Recombinant Flag/His fusion protein corresponding to amino acids 58-205 of human LTA. |
Immunogen sequence/protein sequence: | HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Protein accession: | AAH34729.1 |
Form: | Liquid |
Recommend dilutions: | The optimal working dilution should be determined by the end user. |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004049-M50-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004049-M50-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (18.48 KDa) . |
Conjugate tag: | Flag/His |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |