LTA monoclonal antibody (M11), clone 2H8 View larger

LTA monoclonal antibody (M11), clone 2H8

H00004049-M11_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LTA monoclonal antibody (M11), clone 2H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LTA monoclonal antibody (M11), clone 2H8

Brand: Abnova
Reference: H00004049-M11
Product name: LTA monoclonal antibody (M11), clone 2H8
Product description: Mouse monoclonal antibody raised against a partial recombinant LTA.
Clone: 2H8
Isotype: IgG1, kappa
Gene id: 4049
Gene name: LTA
Gene alias: LT|TNFB|TNFSF1
Gene description: lymphotoxin alpha (TNF superfamily, member 1)
Genbank accession: BC034729.1
Immunogen: Recombinant Flag/His fusion protein corresponding to amino acids 58-205 of human LTA.
Immunogen sequence/protein sequence: HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Protein accession: AAH34729.1
Form: Liquid
Recommend dilutions: The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004049-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (19.69 KDa) .
Conjugate tag: Flag/His
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LTA monoclonal antibody (M11), clone 2H8 now

Add to cart