LOXL2 monoclonal antibody (M05), clone 3C5 View larger

LOXL2 monoclonal antibody (M05), clone 3C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOXL2 monoclonal antibody (M05), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about LOXL2 monoclonal antibody (M05), clone 3C5

Brand: Abnova
Reference: H00004017-M05
Product name: LOXL2 monoclonal antibody (M05), clone 3C5
Product description: Mouse monoclonal antibody raised against a partial recombinant LOXL2.
Clone: 3C5
Isotype: IgG2b Kappa
Gene id: 4017
Gene name: LOXL2
Gene alias: LOR2|WS9-14
Gene description: lysyl oxidase-like 2
Genbank accession: NM_002318
Immunogen: LOXL2 (NP_002309, 675 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Protein accession: NP_002309
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004017-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004017-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged LOXL2 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LOXL2 monoclonal antibody (M05), clone 3C5 now

Add to cart