LMO2 monoclonal antibody (M04), clone 4C6 View larger

LMO2 monoclonal antibody (M04), clone 4C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LMO2 monoclonal antibody (M04), clone 4C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LMO2 monoclonal antibody (M04), clone 4C6

Brand: Abnova
Reference: H00004005-M04
Product name: LMO2 monoclonal antibody (M04), clone 4C6
Product description: Mouse monoclonal antibody raised against a full length recombinant LMO2.
Clone: 4C6
Isotype: IgG2b Kappa
Gene id: 4005
Gene name: LMO2
Gene alias: RBTN2|RBTNL1|RHOM2|TTG2
Gene description: LIM domain only 2 (rhombotin-like 1)
Genbank accession: NM_005574
Immunogen: LMO2 (NP_005565, 16 a.a. ~ 102 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIR
Protein accession: NP_005565
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004005-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.57 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LMO2 monoclonal antibody (M04), clone 4C6 now

Add to cart