Brand: | Abnova |
Reference: | H00004005-M01 |
Product name: | LMO2 monoclonal antibody (M01), clone 6B8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LMO2. |
Clone: | 6B8 |
Isotype: | IgG1 Kappa |
Gene id: | 4005 |
Gene name: | LMO2 |
Gene alias: | RBTN2|RBTNL1|RHOM2|TTG2 |
Gene description: | LIM domain only 2 (rhombotin-like 1) |
Genbank accession: | BC034041 |
Immunogen: | LMO2 (AAH34041, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRPFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI |
Protein accession: | AAH34041 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LMO2 monoclonal antibody (M01), clone 6B8 Western Blot analysis of LMO2 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |