LLGL1 monoclonal antibody (M01), clone 5G2 View larger

LLGL1 monoclonal antibody (M01), clone 5G2

H00003996-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LLGL1 monoclonal antibody (M01), clone 5G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about LLGL1 monoclonal antibody (M01), clone 5G2

Brand: Abnova
Reference: H00003996-M01
Product name: LLGL1 monoclonal antibody (M01), clone 5G2
Product description: Mouse monoclonal antibody raised against a partial recombinant LLGL1.
Clone: 5G2
Isotype: IgG1 Kappa
Gene id: 3996
Gene name: LLGL1
Gene alias: DLG4|HUGL|HUGL-1|HUGL1|LLGL
Gene description: lethal giant larvae homolog 1 (Drosophila)
Genbank accession: NM_004140
Immunogen: LLGL1 (NP_004131, 911 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
Protein accession: NP_004131
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003996-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003996-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged LLGL1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Hugl1 and hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.Russ A, Louderbough JM, Zarnescu D, Schroeder JA.
PLoS One. 2012;7(10):e47734. doi: 10.1371/journal.pone.0047734. Epub 2012 Oct 23.

Reviews

Buy LLGL1 monoclonal antibody (M01), clone 5G2 now

Add to cart