FADS3 monoclonal antibody (M07A), clone 3D2 View larger

FADS3 monoclonal antibody (M07A), clone 3D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FADS3 monoclonal antibody (M07A), clone 3D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about FADS3 monoclonal antibody (M07A), clone 3D2

Brand: Abnova
Reference: H00003995-M07A
Product name: FADS3 monoclonal antibody (M07A), clone 3D2
Product description: Mouse monoclonal antibody raised against a partial recombinant FADS3.
Clone: 3D2
Isotype: IgG2b Kappa
Gene id: 3995
Gene name: FADS3
Gene alias: CYB5RP|LLCDL3
Gene description: fatty acid desaturase 3
Genbank accession: NM_021727
Immunogen: FADS3 (NP_068373, 16 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
Protein accession: NP_068373
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003995-M07A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003995-M07A-2-A8-1.jpg
Application image note: FADS3 monoclonal antibody (M07A), clone 3D2. Western Blot analysis of FADS3 expression in human placenta.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FADS3 monoclonal antibody (M07A), clone 3D2 now

Add to cart