Brand: | Abnova |
Reference: | H00003995-M07A |
Product name: | FADS3 monoclonal antibody (M07A), clone 3D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FADS3. |
Clone: | 3D2 |
Isotype: | IgG2b Kappa |
Gene id: | 3995 |
Gene name: | FADS3 |
Gene alias: | CYB5RP|LLCDL3 |
Gene description: | fatty acid desaturase 3 |
Genbank accession: | NM_021727 |
Immunogen: | FADS3 (NP_068373, 16 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE |
Protein accession: | NP_068373 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FADS3 monoclonal antibody (M07A), clone 3D2. Western Blot analysis of FADS3 expression in human placenta. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |