Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LLGL2 monoclonal antibody (M06), clone 4G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about LLGL2 monoclonal antibody (M06), clone 4G2
| Brand: | Abnova |
| Reference: | H00003993-M06 |
| Product name: | LLGL2 monoclonal antibody (M06), clone 4G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LLGL2. |
| Clone: | 4G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3993 |
| Gene name: | LLGL2 |
| Gene alias: | HGL|LGL2 |
| Gene description: | lethal giant larvae homolog 2 (Drosophila) |
| Genbank accession: | NM_004524 |
| Immunogen: | LLGL2 (NP_004515, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR |
| Protein accession: | NP_004515 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to LLGL2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Hugl1 and hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.Russ A, Louderbough JM, Zarnescu D, Schroeder JA. PLoS One. 2012;7(10):e47734. doi: 10.1371/journal.pone.0047734. Epub 2012 Oct 23. |